PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.27991s0061.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 241aa    MW: 27549.7 Da    PI: 9.535
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.27991s0061.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.5e-20666257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          ++R+++t+eql +Lee++++  r+p+a ++++++++l    +++ ++V++WFqN++a++++
  Bostr.27991s0061.1.p  6 STRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66
                          58*****************99*************************************996 PP

2Wus_type_Homeobox120.28.6e-39567264
     Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                          a+tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
  Bostr.27991s0061.1.p  5 ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67
                          589***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0013471IPR001356Homeobox domain
SuperFamilySSF466896.42E-11766IPR009057Homeodomain-like
PfamPF000461.5E-17766IPR001356Homeobox domain
CDDcd000867.61E-5767No hitNo description
Gene3DG3DSA:1.10.10.604.4E-7866IPR009057Homeodomain-like
PROSITE profilePS500719.7661267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MSPVASTRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH  60
KARDRQKLRK KLAKQLHQQQ HQLQLQLQQI KPKPISSMMS QPINNNIIDH HNPYHHHHHN  120
HHRPYDHMSF ACCSHPSPMC LPHPGNGGDA QSKVVNEYYC TKSGAEEMLM QKPITGPNSS  180
YGRDWMMMMD MGPRPSYPSS SSSSPIPCCN MMMSSAKIPL KTLELFPISS INSKQDSTKL  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0589200.0AB058920.1 Arabidopsis thaliana PRS mRNA for PRESSED FLOWER, complete cds.
GenBankAY2513970.0AY251397.1 Arabidopsis thaliana PRS/WOX3 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010414499.11e-137PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ9SIB41e-128WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLD7LJM21e-127D7LJM2_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.4__832__AT2G28610.11e-127(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74802642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-93WOX family protein